Recombinant Human CXCL3/GRO-gamma/MIP2-beta Protein

Size

£133.00

SKU:: RP01403
Additional Names:: CXCL3,CINC-2b,GRO3,GROg,MIP-2b,MIP2B,SCYB3
Molecular Weight:: 10-15 kDa
Purity:: ≥85%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ala35-Asn107
Formulation:: Recombinant Human CXCL3/GRO-gamma/MIP2-beta Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala35-Asn107) of human CXCL3/GRO gamma (Accession #NP_002081.2) fused with no additional amino acid.
Species:: Human
Sequence:: ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Uniprot:: P19876
Synonyms:: C-X-C motif chemokine 3;chemokine (C-X-C motif) ligand 3;CINC-2b;GRO-gamma;GRO-gamma(1-73);GRO3;GRO3 oncogene;GROg;growth-regulated protein gamma;macrophage inflammatory protein 2-beta;melanoma growth stimulatory activity gamma;MGSA gamma;MIP-2b;MIP2-beta;MIP2B;SCYB3
Extra Details:: CXCL3 is involved in migration, invasion, proliferation and tubule formation of trophoblasts and may play a key role in the pathogenesis of preeclampsia. CXCL3 autocrine/paracrine pathways are involved in the development of prostate cancer by regulating the expression of the target genes that are related to the progression of malignancies. CXCL3 is a novel adipokine that facilitates adipogenesis in an autocrine and/or a paracrine manner through induction of c/ebpb and c/ebpd. CXCL3 and its receptor CXCR2 are overexpressed in prostate cancer cells, prostate epithelial cells and prostate cancer tissues, which may play multiple roles in prostate cancer progression and metastasis.

Shipping Conditions:: Blue Ice