Recombinant Mouse TNFRSF1B/TNF-R2/CD120b Protein

Size

£133.00

SKU:: RP01395
Additional Names:: TNFRSF1B,CD120b,TBPII,TNF-R-II,TNF-R75,TNFBR,TNFR1B,TNFR2,TNFR80,p75,TNFRSF1B,TNFRSF1B,CD120b,TBPII,TNF-R-II,TNF-R75,TNFBR,TNFR1B,TNFR2,TNFR80,p75,TNFRSF1B
Molecular Weight:: 60-75 kDa
Purity:: ≥ 95 % as determined by SDS-PAGE;≥95 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Val23-Gly258
Formulation:: Recombinant Mouse TNFRSF1B/TNF-R2/CD120b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val23-Gly258) of mouse TNFR2/CD120b/TNFRSF1B (Accession #NP_035740.2) fused with a hFc tag at the C-terminus.
Species:: Mouse
Sequence:: VPAQVVLTPYKPEPGYECQISQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTDAVCAPESPTLSAIPRTLYVSQPEPTRSQPLDQEPGPSQTPSILTSLGSTPIIEQSTKGG
Uniprot:: P25119
Synonyms:: CD120b;p7;p75;p75 TNFR;p80 TNF-alpha receptor;TN;Tnf;TNF receptor beta chain;TNF-;TNF-a;TNF-alphaR2;TNF-R;TNF-R-II;TNF-R2;TNF-R75;TNF-RII;TNFal;TNFalpha-R2;TNFBR;TNFR;Tnfr-1;TNFR-II;Tnfr2;TNFR80;TNFRII;tumor necrosis factor receptor 2;tumor necrosis factor receptor superfamily member 1B;tumor necrosis factor receptor type II
Extra Details:: Tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B), also known as Tumor necrosis factor receptor 2 (TNFR2) or CD120b antigen, is a member of the tumor necrosis factor receptor superfamily. TNFR2/CD120b/TNFRSF1B is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways. TNFR2/CD120b/TNFRSF1B is not a major contributing factor to the genetic risk of type 2 diabetes, its associated peripheral neuropathy and hypertension and related metabolic traits in North Indians. Tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B) has been reported to be associated with SLE risk in Japanese populations. TNFR2/CD120b/TNFRSF1B serves as a receptor with high affinity for TNFSF2 and approximately 5-fold lower affinity for homotrimeric TNFSF1. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.

Shipping Conditions:: Blue Ice