Recombinant Mouse IL-3 Protein

Size

£133.00

SKU:: RP01386
Additional Names:: BPA,Csfmu,HCGF,IL-3,MCGF,PSF,IL3
Molecular Weight:: 10-35 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Met1-Cys166
Formulation:: Recombinant Mouse IL-3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Cys166) of mouse IL3 (Accession #NP_034686.2.) fused with a 6xHis tag at the C-terminus.
Species:: Mouse
Sequence:: MVLASSTTSIHTMLLLLLMLFHLGLQASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC
Uniprot:: P01586
Synonyms:: B;BPA;Csfm;Csfmu;HCGF;hematopoietic growth factor;Il;Il-3;interleukin-3;mast cell growth factor;MCGF;multipotential colony-stimulating factor;P;P-cell-stimulating factor;PSF
Extra Details:: IL3 (interleukin 3), also known as IL-3, is a potent growth-promoting cytokine that belongs to the IL-3 family. IL3/IL-3 also belongs to the group of interleukins. Interleukins are produced by a wide variety of body cells. The function of the immune system depends in a large part on interleukins, and rare deficiencies of a number of them have been described, all featuring autoimmune diseases or immune deficiency. The majority of interleukins are synthesized by helper CD4+ T lymphocytes, as well as through monocytes, macrophages, and endothelial cells. They promote the development and differentiation of T, B, and hematopoietic cells. IL3/IL-3 is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation, and apoptosis. IL3/IL-3 has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders.

Shipping Conditions:: Blue Ice