Recombinant Human Fc gamma RIIA/FCGR2A/CD32a (H167R) Protein

Size

£113.05

Was £133.00

SKU:: RP01383
Additional Names:: FCGR2A,CD32,CD32A,CDw32,FCG2,FCGR2,FCGR2A1,FcGR,IGFR2
Molecular Weight:: 60-65 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ala36-Ile218(H167R)
Formulation:: Recombinant Human Fc gamma RIIA/FCGR2A/CD32a (H167R) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala36-Ile218(R167)) of human FCGR2A/CD32a(R167) (Accession #NP_001129691.1) fused with a Fc, 6xHis tag at the C-terminus.
Species:: Human
Sequence:: AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVRITVQVPSMGSSSPMGI
Uniprot:: P12318
Synonyms:: CD32;CD32A;CDw32;Fc fragment of IgG, low affinity IIa, receptor (CD32);Fc gamma receptor RIIa3;Fc-gamma RII-a;fc-gamma-RIIa;FCG2;FcGR;FCGR2;FCGR2A1;fcRII-a;IGFR2;igG Fc receptor II-a;Immunoglobulin G Fc receptor II;low affinity immunoglobulin gamma Fc region receptor II-a
Extra Details:: Receptors for the Fc region of IgG (Fc G Gamma R) are members of the Ig superfamily that function in the activation or inhibition of immune responses. Three classes of human Fc G Gamma Rs: RI (CD64), RII (CD32), and RIII (CD16), which generate multiple isoforms, are recognized. There are three genes for human FcG Gamma RII /CD32 (A, B, and C) and one for mouse FcG Gamma RII B (CD32B). CD32 is a low affinity receptor for IgG. The activating isoform, CD32A, is expressed on monocytes, neutrophils, platelets and dendritic cells. CD32A is expressed on many immune cell types (macrophage, neutrophil, eosinophils, platelets, dendritic cells and Langerhan cells), where inhibitory ITIM-bearing receptors may also be coexpressed and co-engaged by specific ligands. CD32A delivers an activating signal upon ligand binding, and results in the initiation of inflammatory responses including cytolysis, phagocytosis, degranulation and cytokine production. The responses can be modulated by signals from the coexpressed inhibitory receptors such as CD32B, and the strength of the signal is dependent on the ratio of expression of the activating and inhibitory receptors.

Shipping Conditions:: Blue Ice