Recombinant Human Myelin oligodendrocyte glycoprotein/MOFG Protein

Size

£133.00

SKU:: RP01361
Additional Names:: BTN6, BTNL11, MOGIG2, NRCLP7,MOG,BTNL11,MOGIG2,NRCLP7
Molecular Weight:: 15-25 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gly30-Gly154
Formulation:: Recombinant Human Myelin oligodendrocyte glycoprotein/MOFG Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly30-Gly154) of human MOG (Accession #NP_996532.2) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG
Uniprot:: Q16653
Synonyms:: BTN6;BTNL11;MOG alpha-5;MOG AluA;MOG AluB;MOG Ig-AluB;MOGIG2;myelin-oligodendrocyte glycoprotein;NRCLP7
Extra Details:: Myelin oligodendrocyte glycoprotein (MOG) is a transmembrane protein belonging to the immunoglobulin superfamily and contains an Ig-like domain followed by two potential membrane-spanning regions. MOG is expressed only in the CNS with very low content (approximately 0.1% total proteins) in the oligodendrogliocyte membrane. Three possible functions for MOG were suggested: (a) a cellular adhesive molecule, (b) a regulator of oligodendrocyte microtubule stability, and (c) a mediator of interactions between myelin and the immune system, in particular, the complement cascade. A direct interaction might exist between the membrane-associated regions of MOG and the myelin-specific glycolipid galactocerebroside (Gal-C), and such an interaction may have important consequences regarding the membrane topology and function of both molecules. It is considered that MOG is an autoantigen capable to produce demyelinating multiple sclerosis-like diseases in experimental animals.

Shipping Conditions:: Blue Ice