Recombinant Human B7-H6/NCR3LG1 Protein

Size

£133.00

SKU:: RP01356
Additional Names:: B7-H6,NCR3LG1,B7 Homolog 6,NCR3LG1
Molecular Weight:: 40-60 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Asp25-Ser262
Formulation:: Recombinant Human B7-H6/NCR3LG1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp25-Ser262) of human B7-H6/NCR3LG1 (Accession #NP_001189368.1) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFS
Uniprot:: Q68D85
Synonyms:: B7 homolog 6;B7-H6;B7H6;DKFZp686O24166;natural cytotoxicity triggering receptor 3 ligand 1;putative Ig-like domain-containing protein DKFZp686O24166/DKFZp686I21167
Extra Details:: Natural cytotoxicity triggering receptor 3 ligand 1(B7-H6) is a glycosylated member of the B7 family of immune costimulatory proteins. Mature human B7-H6 consists of a 238 amino acid (aa) extracellular domain (ECD) that contains one Ig-like V domain and one Ig-like C1 domain, a 21 aa transmembrane segment, and a 171 aa cytoplasmic domain that contains one ITIM, one SH2, and one SH3 motif. Both of the Ig-like domains carry N-linked glycosylation. The Ig-like V domain mediates 1:1 stoichiometric binding of B7-H6 to NKp30 expressed on NK cells. It does not show binding to NKp44, NKp46, or NKG2D. Ligation of NKp30 by B7-H6 induces NK cell activation and target cell cytolysis. B7-H6 is expressed on a wide range of hematopoietic, carcinoma, and melanoma tumor cells, which is consistent with the detection of NKp30 binding sites on many tumors.

Shipping Conditions:: Blue Ice