RP01322
Recombinant Rat TNF-alpha Protein

Size
£193.00
- SKU:
- RP01322
- Additional Names:
- DIF,TNF-alpha,TNFA,TNFSF2,cachexin,cachectin,TNFA Alpha,TNFA
- Molecular Weight:
- 18 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Leu80-Leu235
- Formulation:
- Recombinant Rat TNF-alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu80-Leu235) of Rat TNFA (Accession #NP_036807.1) fused with an 6xHis tag at the C-terminus.
- Species:
- Rat
- Sequence:
- LRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYS QVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLG GVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL
- Uniprot:
- P16599
- Synonyms:
- cachectin;RATTNF;TNF-alpha;Tnfa;tumor necrosis factor;tumor necrosis factor (TNF superfamily, member 2);tumor necrosis factor ligand superfamily member 2
- Extra Details:
- Tumor necrosis factor alpha is a cytokine produced primarily by monocytes and macrophages. It is found in synovial cells and macrophages in the tissues.The primary role of TNFA Alpha is in the regulation of immune cells. TNFA Alpha is able to induce apoptotic cell death, to induce inflammation, and to inhibit tumorigenesis and viral replication. Dysregulation of TNFA Alpha production has been implicated in a variety of human diseases, including major depression, Alzheimer's disease and cancer. Recombinant TNFA Alpha is used as an immunostimulant under the INN tasonermin.TNF-alpha is involved in fighting against the tumorigenesis, thus, is regarded as a molecular insight in cancer treatment.
- Shipping Conditions:
- Blue Ice



