RP01321
Recombinant Mouse IL-6 Protein

Size
£145.00
- SKU:
- RP01321
- Additional Names:
- IL6,Interleukin-6,BSF2,HSF,IFNB2,IL6
- Molecular Weight:
- 25-35 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Phe25-Thr211
- Formulation:
- Recombinant Mouse IL-6 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe25-Thr211) of Mouse IL6 (Accession #NP_112445.1) fused with an 6xHis tag at the C-terminus.
- Species:
- Mouse
- Sequence:
- FPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALA ENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQR DTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVT LRSTRQT
- Uniprot:
- P08505
- Synonyms:
- B-cell hybridoma growth factor;Il;Il-6;interleukin HP-1;interleukin-6
- Extra Details:
- Interleukin-6 is a multifunctional A Alpha-helical cytokine that regulates cell growth and differentiation of various tissues, which is known particularly for its role in the immune response and acute phase reactions.It is secreted by T cells, macrophages , monocytes, fibroblasts,endothelial cells,et.al. to stimulate immune response to trauma, especially burns or other tissue damage leading to inflammation.Interleukin 6 has been shown to interact with interleukin-6 receptor and glycoprotein. IL-6 is relevant to many disease processes such as diabetes,atherosclerosis, depression,Alzheimer's Disease,systemic,lupus erythematosus,prostate cancer and rheumatoid arthritis.
- Shipping Conditions:
- Blue Ice



