RP01306
Recombinant Human CD47 Protein
Size
£240.00
- SKU:
- RP01306
- Additional Names:
- CD47, IAP, MER6, OA3, CD47 molecule,IAP,MER6,OA3
- Molecular Weight:
- 35-45 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Gln19-Pro139
- Formulation:
- Recombinant Human CD47 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-Pro139) of human CD47 (Accession #NP_001768.1) fused with an 6xHis tag at the C-terminus.
- Species:
- Human
- Sequence:
- QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
- Uniprot:
- Q08722
- Synonyms:
- antigen identified by monoclonal antibody 1D8;antigenic surface determinant protein OA3;CD47 antigen (Rh-related antigen, integrin-associated signal transducer);CD47 glycoprotein;IAP;integrin associated protein;Integrin-associated protein;integrin-associated signal transducer;leukocyte surface antigen CD47;MER6;OA3;Protein MER6;Rh-related antigen
- Extra Details:
- This protein is a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.
- Shipping Conditions:
- Blue Ice