RP01245
Recombinant Human CD8a Protein

Size
£145.00
- SKU:
- RP01245
- Additional Names:
- CD8, Leu2, MAL, p32,CD8A,Leu2,MAL,p32
- Molecular Weight:
- 55-60 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ser22-Asp182
- Formulation:
- Recombinant Human CD8a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser22-Asp182) of human CD8 alpha (Accession #NP_001759.3) fused with a Fc, 6xHis tag at the C-terminus.
- Species:
- Human
- Sequence:
- SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
- Uniprot:
- P01732
- Synonyms:
- CD8;CD8 antigen, alpha polypeptide (p32);Leu2;Leu2 T-lymphocyte antigen;OKT8 T-cell antigen;p32;T cell co-receptor;T-cell antigen Leu2;T-cell surface glycoprotein CD8 alpha chain;T-lymphocyte differentiation antigen T8/Leu-2;T8 T-cell antigen
- Shipping Conditions:
- Blue Ice



