Recombinant Human IL-15 Protein

Size

£145.00

SKU:: RP01236
Additional Names:: IL15,IL-15
Molecular Weight:: 15 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Asn49-Ser162
Formulation:: Recombinant Human IL-15 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Asn49-Ser162) of human IL-15 (Accession #NP_000576.1) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Uniprot:: P40933-1
Synonyms:: IL-15;interleukin-15