Recombinant Mouse CD28 Protein

Size

£127.00

SKU:: RP01211
Additional Names:: CD28,Tp44,CD28
Molecular Weight:: 55-70 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Asn20-Lys149
Formulation:: Recombinant Mouse CD28 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn20-Lys149) of mouse CD28 (Accession #NP_031668.3) fused with a Fc, 6xHis tag at the C-terminus.
Species:: Mouse
Sequence:: NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPK
Uniprot:: P31041
Synonyms:: T-cell-specific surface glycoprotein CD28