RP01198
Recombinant Human MERTK Protein

Size
£145.00
- SKU:
- RP01198
- Additional Names:
- MER, RP38, Tyro12, c-Eyk, c-mer,MERTK,RP38,Tyro12,c-Eyk,c-mer
- Molecular Weight:
- 70-120 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Arg26-Ala499
- Formulation:
- Recombinant Human MERTK Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg26-Ala499) of human Mer/MERTK (Accession #NP_006334.2) fused with a 6xHis tag at the C-terminus.
- Species:
- Human
- Sequence:
- REEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSISVPNIYQDTTISWWKDGKELLGAHHAITQFYPDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINIKAIPSPPTEVSIRNSTAHSILISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQALANYSIGVSCMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGYRISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTRGGVGPFSDPVKIFIPAHGWVDYAPSSTPAPGNA
- Uniprot:
- Q12866
- Synonyms:
- c-Eyk;c-mer;c-mer proto-oncogene tyrosine kinase;MER;MER receptor tyrosine kinase;proto-oncogene c-Mer;receptor tyrosine kinase MerTK;RP38;STK kinase;Tyro12;tyrosine-protein kinase Mer
- Shipping Conditions:
- Blue Ice



