RP01159
Recombinant Human TREM2 Protein
Size
£133.00
- SKU:
- RP01159
- Additional Names:
- PLOSL2, TREM-2, Trem2a, Trem2b, Trem2c,TREM2,TREM-2,Trem2a,Trem2b,Trem2c
- Molecular Weight:
- 25-39 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- His19-Ser174
- Formulation:
- Recombinant Human TREM2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His19-Ser174) of human TREM-2 (Accession #NP_061838) fused with a 6xHis tag at the C-terminus.
- Species:
- Human
- Sequence:
- HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
- Uniprot:
- Q9NZC2
- Synonyms:
- PLOSL2;TREM-2;Trem2a;Trem2b;Trem2c;triggering receptor expressed on monocytes 2;triggering receptor expressed on myeloid cells 2;triggering receptor expressed on myeloid cells 2a
- Shipping Conditions:
- Blue Ice