RP01147
Recombinant Mouse IL-17F Protein
Size
£133.00
- SKU:
- RP01147
- Additional Names:
- IL17F,IL24,ML-1,Interleukin-17F,IL17F
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Met1-Ala161
- Formulation:
- Recombinant Mouse IL-17F Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Ala161) of mouse IL-17F (Accession #NP_665855.2) fused with a 6xHis tag at the C-terminus.
- Species:
- Mouse
- Sequence:
- MKCTRETAMVKSLLLLMLGLAILREVAARKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
- Uniprot:
- Q7TNI7
- Synonyms:
- C87042;IL-17F;interleukin-17F
- Shipping Conditions:
- Blue Ice