Recombinant Human FGF-10 Protein

Size

£145.00

SKU:: RP01140
Additional Names:: Fibroblast growth factor 10, FGF-10, Keratinocyte growth factor 2,FGF10,KGF2
Molecular Weight:: 20-25 kDa
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
ABP:: No Import Docs
Immunogen:: Gln38-Ser208
Formulation:: Recombinant Human FGF-10 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gln38-Ser208) of human FGF10 (Accession #NP_004456.1).
Species:: Human
Sequence:: QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
Uniprot:: O15520
Synonyms:: FGF-10;fibroblast growth factor 10;keratinocyte growth factor 2;produced by fibroblasts of urinary bladder lamina propria
Extra Details:: This protein is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein exhibits mitogenic activity for keratinizing epidermal cells, but essentially no activity for fibroblasts, which is similar to the biological activity of FGF7. Studies of the mouse homolog of suggested that this gene is required for embryonic epidermal morphogenesis including brain development, lung morphogenesis, and initiation of lim bud formation. This gene is also implicated to be a primary factor in the process of wound healing.

Shipping Conditions:: Blue Ice