Recombinant Human Serpin B3/SCCA-1 Protein

Size

£145.00

SKU:: RP01110
Additional Names:: SERPINB3, HsT1196, SCC, SCCA-1, SCCA-PD, SCCA1, SSCA1, T4-A, serpin B3,SerpinB3,HsT1196,SCC,SCCA-1,SCCA-PD,SCCA1,SSCA1,T4-A,serpin B3
Molecular Weight:: 50-65 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Met1-Pro390
Formulation:: Recombinant Human Serpin B3/SCCA-1 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Met1-Pro390) of human Serpin B3 (Accession #P29508) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Uniprot:: P29508
Synonyms:: HsT1196;protein T4-A;SCC;SCCA-1;SCCA-PD;SCCA1;serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3;serpin B3;serpin peptidase inhibitor, clade B (ovalbumin), member 3;squamous cell carcinoma antigen 1;SSCA1;T4-A
Extra Details:: Serpin B3, also known as squamous cell carcinoma antigen-1 (SCCA-1), is a member of the serpin superfamily of serine protease inhibitors. Serpin B3 belongs to the subgroup ovalbumin-related serpins which are involved in the regulation of apoptosis, inflammation, angiogenesis and embryogenesis. It may act as a papain-like cysteine protease inhibitor to modulate the host immune response against tumor cells. It also functions as an inhibitor of UV-induced apoptosis via suppression of the activity of c-Jun NH(2)-terminal kinase (JNK1).

Shipping Conditions:: Blue Ice