RP01095
Recombinant Human Serum amyloid A-1/SAA1 Protein
Size
£193.00
- SKU:
- RP01095
- Additional Names:
- SAA1,PIG4,SAA,SAA2,TP53I4
- Molecular Weight:
- 14 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Arg19-Tyr122
- Formulation:
- Recombinant Human Serum amyloid A-1/SAA1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg19-Tyr122) of human SAA1 (Accession #P0DJI8) fused with a 6xHis tag at the N-terminus.
- Species:
- Human
- Sequence:
- RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY
- Uniprot:
- P0DJI8
- Synonyms:
- PIG4;SAA;SAA2;serum amyloid A protein;serum amyloid A-1 protein;TP53I4;tumor protein p53 inducible protein 4
- Extra Details:
- This protein is a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11.
- Shipping Conditions:
- Blue Ice