RP01076
Recombinant Mouse IFN-beta Protein
Size
£145.00
- SKU:
- RP01076
- Additional Names:
- Fibroblast interferon,IFBIFNB,IFF,IFNB1,IFNbeta,IFN-beta,interferon beta, IFNB
- Molecular Weight:
- 60 kda
- Purity:
- ≥ 90 % as determined by SDS-PAGE;≥ 90 %
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ile22-Asn182
- Formulation:
- Recombinant Mouse IFN-beta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile22-Asn182) of mouse Interferon beta (Accession #NP_034640.1) fused with an Fc, 6xHis tag at the C-terminus.
- Species:
- Mouse
- Sequence:
- INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN
- Uniprot:
- P01575
- Synonyms:
- If;If1da1;Ifb;IFN-b;IFN-beta;IFNB;interferon 1da1;interferon beta
- Shipping Conditions:
- Blue Ice