RP01071
Recombinant Mouse TNF-alpha Protein
Size
£145.00
- SKU:
- RP01071
- Additional Names:
- DIF, Tnfa, TNF-a, TNFSF2, Tnlg1f, Tnfsf1a, TNFalpha, TNF-alpha,TNF
- Molecular Weight:
- 18 kDa
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Leu80-Leu235
- Formulation:
- Recombinant Mouse TNF-alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu80-Leu235) of mouse TNF-alpha (Accession #NP_038721.1) fused with a 6xHis tag at the C-terminus.
- Species:
- Mouse
- Sequence:
- LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
- Uniprot:
- P06804
- Synonyms:
- cachectin;DI;DIF;Tn;TNF-;TNF-a;TNF-alpha;Tnfa;TNFalpha;Tnfs;Tnfsf1a;TNFSF2;Tnlg1f;tumor necrosis factor;tumor necrosis factor ligand 1f;tumor necrosis factor ligand superfamily member 2;tumor necrosis factor-alpha
- Shipping Conditions:
- Blue Ice