RP01070
Recombinant Mouse IFN-gamma Protein

Size
£145.00
- SKU:
- RP01070
- Additional Names:
- IFG,IFI,IFN gamma,Interferon Gamma,IFNG
- Molecular Weight:
- 55 kDa
- Purity:
- ≥ 90 % as determined by SDS-PAGE;≥ 90 %
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Met1-Cys155
- Formulation:
- Recombinant Mouse IFN-gamma Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Cys155) of mouse Interferon Gamma (Accession #NP_032363.1) fused with an Fc, 6xHis tag at the C-terminus.
- Species:
- Mouse
- Sequence:
- MNATHCILALQLFLMAVSGCYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
- Uniprot:
- P01580
- Synonyms:
- gamma interferon;If;If2f;Ifg;IFN-g;IFN-gamma;interferon 2f;interferon gamma
- Extra Details:
- Interferon-gamma (IFN-gamma ) is a secreted protein which belongs to the type II interferon family. IFN-gamma is produced by a variety of immune cells under inflammatory conditions, notably by T cells and NK cells. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. Interferon-gamma is a central regulator of the immune response and signals via the Janus Activated Kinase (JAK)-Signal Transducer and Activator of Transcription (STAT) pathway.
- Shipping Conditions:
- Blue Ice






