RP01058
Recombinant Mouse Flt3 ligand/Flt3L Protein
Size
£133.00
- SKU:
- RP01058
- Additional Names:
- FLT3LG,FL,FLT3L,Flt3 ligand,FLT3LG
- Molecular Weight:
- 56 kDa
- Purity:
- ≥85%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Met1-Arg188
- Formulation:
- Recombinant Mouse Flt3 ligand/Flt3L Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met1-Arg188) of mouse Flt-3 Ligand (Accession #NP_038548.3.) fused with an Fc, 6xHis tag at the C-terminus.
- Species:
- Mouse
- Sequence:
- MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPR
- Uniprot:
- P49772
- Synonyms:
- flt3 ligand;Flt3lg;fms-related tyrosine kinase 3 ligand;Ly72L;SL cytokine
- Shipping Conditions:
- Blue Ice