RP01055
Recombinant Mouse c-Kit ligand/KITLG/SCF Protein
Size
£145.00
- SKU:
- RP01055
- Additional Names:
- KITLG,FPH2,KL-1,Kitl,MGF,SCF,SF,SHEP7,KL,SCF/KITLG
- Molecular Weight:
- 18-38 kDa
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Lys26-Ala189
- Formulation:
- Recombinant Mouse c-Kit ligand/KITLG/SCF Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Lys26-Ala189) of mouse SCF (Accession #NP_038626.1.) fused with a 6xHis tag at the C-terminus.
- Species:
- Mouse
- Sequence:
- KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
- Uniprot:
- P20826-1
- Synonyms:
- bl;blz;C-kit ligand;Clo;cloud gray;Con;contrasted;Gb;grizzle-belly;hematopoietic growth factor KL;Kit;kit ligand;Kitlg;mast cell growth factor;Mgf;S;SC;SCF;SF;Sl;SLF;Ste;Steel factor;stem cell factor
- Shipping Conditions:
- Blue Ice