Recombinant Human TWSG1 Protein

Size

£145.00

SKU:: RP01049
Additional Names:: TSG,TSGtwisted gastrulation protein homolog 1,TWSG1,TWSG1
Molecular Weight:: 35-40kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Met1-Phe223
Formulation:: Recombinant Human TWSG1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met1-Phe223) of human TWSG1 (Accession #NP_065699.1) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: MKLHYVAVLTLAILMFLTWLPESLSCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
Uniprot:: Q9GZX9
Synonyms:: TSG;twisted gastrulation homolog 1;twisted gastrulation protein homolog 1