Recombinant Human Fc-gamma RIII alpha/FCGR3A /CD16a Protein

Size

£133.00

SKU:: RP01043
Additional Names:: CD16,CD16A,FCG3,FCGR3,FCGRIII,FCR-10,FCRIII,FCRIIIA,IGFR3,IMD20,FCGR3A, CD16, CD16A, FCG3, FCGR3, FCGRIII, FCR-10, FCRIII, FCRIIIA, IGFR3, IMD20, Fc fragment of IgG receptor IIIa
Molecular Weight:: 70-80 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gly17-Gln208
Formulation:: Recombinant Human Fc-gamma RIII alpha/FCGR3A /CD16a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly17-Gln208) of human Fc gamma RIIIA/CD16a (Accession #NP_001121065.1) fused with an Fc, 6xHis tag at the C-terminus.
Species:: Human
Sequence:: GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
Uniprot:: P08637
Synonyms:: CD16;CD16A;CD16a antigen;Fc fragment of IgG, low affinity III, receptor for (CD16);Fc fragment of IgG, low affinity IIIa, receptor (CD16a);Fc gamma receptor III-A;Fc-gamma receptor III-2 (CD 16);Fc-gamma receptor IIIb (CD16);Fc-gamma RIII-alpha;FCG3;FcgammaRIIIA;FCGR3;FCGRIII;FCR-10;FCRIII;FCRIIIA;IGFR3;igG Fc receptor III-2;IMD20;immunoglobulin G Fc receptor III;low affinity immunoglobulin gamma Fc region receptor III-A;low affinity immunoglobulin gamma receptor III-a Fc fragment;neutrophil-specific antigen NA
Extra Details:: This protein is a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other other antibody-dependent responses. The protein is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia.

Shipping Conditions:: Blue Ice