RP01040
Recombinant Human IL-7 Protein
Size
£163.00
- SKU:
- RP01040
- Additional Names:
- IL7,IL-7
- Molecular Weight:
- 30-35 kDa
- Purity:
- ≥ 90 % as determined by SDS-PAGE;≥ 90 %
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Asp26-His177
- Formulation:
- Active Recombinant Human IL-7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp26-His177) of human IL-7 (Accession #NP_000871.1) fused with a 6xHis tag at the C-terminus.
- Species:
- Human
- Sequence:
- DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
- Uniprot:
- P13232-1
- Synonyms:
- IL-7;interleukin-7
- Shipping Conditions:
- Blue Ice