RP01030
Recombinant Human EGF Protein
Size
£127.00
- SKU:
- RP01030
- Additional Names:
- EGF,HOMG4,URG
- Molecular Weight:
- 40 kDa
- Purity:
- ≥90%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Asn971-Arg1023
- Formulation:
- Recombinant Human EGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn 971-Arg 1023) of human EGF (Accession #NP_001954.2) fused with hFc, 6xHis tag at the C-terminus.
- Species:
- Human
- Sequence:
- NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
- Uniprot:
- P01133
- Synonyms:
- beta-urogastrone;HOMG4;pro-epidermal growth factor;URG
- Extra Details:
- Epidermal growth factor (EGF) is the founding member of the EGF family that also includes TGF-alpha, amphiregulin (AR), betacellulin (BTC), epiregulin (EPR), heparin binding EGF like growth factor (HB_x005f
- Shipping Conditions:
- Blue Ice