Recombinant Human CD83 Protein

Size

£127.00

SKU:: RP00983
Additional Names:: BL11, HB15,CD83,HB15
Molecular Weight:: 15-35 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Thr20-Ala143
Formulation:: Recombinant Human CD83 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr20-Ala143) of human CD83 (Accession #NP_004224.1) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA
Uniprot:: Q01151
Synonyms:: B-cell activation protein;BL11;CD83 antigen;CD83 antigen (activated B lymphocytes, immunoglobulin superfamily);cell surface protein HB15;cell-surface glycoprotein;HB15;hCD83
Extra Details:: Human CD83 is a 40 - 50 kDa member of the Siglec (or sialic-acid-binding immunoglobulin-like lectin) family of transmembrane proteins. CD83 is considered as a marker of mature dendritic cells as well as an adhesion receptor that binds to resting monocytes and a subset of activated CD8+ T cells. In certain conditions, CD83 tended to dimerize or even multimerize through its aberrant intermolecular disulfide bonds. The injection of CD83-Ig can significantly enhaunce the rate of tumor growth and inhibit the T cell growth.