Recombinant Human Frizzled-1/FZD1 Protein

Size

£193.00

SKU:: RP00971
Additional Names:: FZD1
Molecular Weight:: 55-65 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gln73-His253
Formulation:: Recombinant Human Frizzled-1/FZD1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln73-His253) of human Frizzled-1 (Accession #NP_003496.1) fused with an Fc, 6xHis tag at the C-terminus.
Species:: Human
Sequence:: QAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQH
Uniprot:: Q9UP38
Synonyms:: frizzled 1, seven transmembrane spanning receptor;frizzled family receptor 1;frizzled homolog 1;frizzled-1;frizzled, Drosophila, homolog of, 1;fz-1;fzE1;hFz1;Wnt receptor
Extra Details:: This protein belongs to the G-protein coupled receptor Fz/Smo family. FZD1 contains a signal peptide, a cysteine-rich domain in the N-terminal extracellular region, 7 transmembrane domains, and a C-terminal PDZ domain-binding motif. FZD1 is expressed in adult heart, placenta, lung, kidney, pancreas, prostate, and ovary and in fetal lung and kidney. Frizzled is a family of G protein-coupled receptor proteins that serve as receptors in the Wnt signaling pathway and other signaling pathways. When activated, Frizzled leads to activation of Dishevelled in the cytosol. Frizzled proteins and the genes encoding them have been identified in an array of animals, from sponges to humans. Frizzled proteins play key roles in governing cell polarity, embryonic development, formation of neural synapses, cell proliferation, and many other processes in developing and adult organisms. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes.

Shipping Conditions:: Blue Ice