RP00870
Recombinant Human IL-17F Protein
Size
£145.00
- SKU:
- RP00870
- Additional Names:
- IL17F,CANDF6,IL-17F,ML-1,ML1
- Molecular Weight:
- 15-25 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Arg31-Gln163
- Formulation:
- Recombinant Human IL-17F Protein is produced by Human cells expression system. The target protein is expressed with sequence (Arg31-Gln163) of human IL-17F (Accession #Q96PD4) fused with a His tag at the N-terminus.
- Species:
- Human
- Sequence:
- RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ
- Uniprot:
- Q96PD4
- Synonyms:
- CANDF6;cytokine ML-1;IL-17F;interleukin-17F;ML-1;ML1
- Shipping Conditions:
- Blue Ice