RP00762
Recombinant Mouse CD47 Protein

Size
£145.00
- SKU:
- RP00762
- Additional Names:
- Leukocyte Surface Antigen CD47, Antigenic Surface Determinant Protein OA3, Integrin-AssociatedProtein, IAP, Protein MER6, CD47, MER6
- Molecular Weight:
- 25-45 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Gln19-Lys140
- Formulation:
- Recombinant Mouse CD47/IAP/OA3 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gln19-Lys140) of mouse CD47/IAP/OA3 (Accession #Q61735-1) fused with a 6xHis tag at the C-terminus.
- Species:
- Mouse
- Sequence:
- QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK
- Uniprot:
- Q61735-1
- Synonyms:
- 9130415E20Rik;AA407862;AI848868;AW108519;B430305P08Rik;IAP;integrin-associated protein;It;Itgp;leukocyte surface antigen CD47;Rh-related antigen
- Extra Details:
- CD47, also known as Integrin-Associated Protein (IAP) and OA3, is a glycosylated atypical member of theimmunoglobulin superfamily. Mouse CD47 is an integral membrane protein that consists of a extracellulardomain (ECD) with a single Ig-like domain, five membrane-spanning regions with short intervening loops, andC-terminal cytoplasmic tail. CD47 has a role in both cell adhesion by acting as an adhesion receptor for THBS1on platelets, and in the modulation of integrins. It plays an important role in memory formation and synapticplasticity in the hippocampus. As a receptor for SIRPA, it binding to which prevents maturation of immaturedendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediatescellcell adhesion, it enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cellactivation. It may play a role in membrane transport and/or integrin dependent signal transduction. It alsoprevents premature elimination of red blood cells.
- Shipping Conditions:
- Blue Ice

