RP00759
Recombinant Mouse IFN-alpha 5 Protein
Size
£133.00
- SKU:
- RP00759
- Additional Names:
- Ifna5, If1ai12, Interferon 1ai12, Interferon alpha 5
- Molecular Weight:
- 20-25 KDa
- Purity:
- ≥90%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Cys24-Glu189
- Formulation:
- Recombinant Mouse IFN-alpha 5 Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Cys24-Glu189) of Mouse IFN-alpha 5(Accession #NP_034635.2) fused with His tag at the C-Terminus.
- Species:
- Mouse
- Sequence:
- CDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFGFPQEKVGAQQIQEAQAIPVLSELTQQVLNIFTSKDSSAAWNATLLDSFCNEVHQQLNDLKACVMQQVGVQESPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLARLSKEE
- Uniprot:
- Q810G2
- Synonyms:
- If;If1ai12;Ifa5;IFN-alpha-5;interferon 1ai12;interferon alpha family, gene 5;interferon alpha-5
- Extra Details:
- IFN-alpha 5 belongs to the alpha/beta interferon family. IFNA5 is the only IFNA subtype detected in normal liver, while a mixture of subtypes is observed in the liver tissue of patients with chronic hepatitis C. Interferons are produced by macrophages, IFN-alpha has antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
- Shipping Conditions:
- Blue Ice