Recombinant Mouse IFN-alpha 4 Protein

Size

£133.00

SKU:: RP00756
Additional Names:: Ifna4, Interferon alpha-4, IFN-alpha-4
Molecular Weight:: 20-30 KDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Leu23-Glu186
Formulation:: Recombinant Mouse IFN-alpha 4 Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Leu23-Glu186) ofMouse IFN-alpha 4(Accession #NP_034634.1) fused with His tag at the C-Terminus.
Species:: Mouse
Sequence:: LGCDLPHTYNLGNKRALTVLEEMRRLPPLSCLKDRKDFGFPLEKVDNQQIQKAQAILVLRDLTQQILNLFTSKDLSATWNATLLDSFCNDLHQQLNDLKACVMQEPPLTQEDSLLAVRTYFHRITVYLRKKKHSLCAWEVIRAEVWRALSSSTNLLARLSEEKE
Uniprot:: P07351
Synonyms:: If;If1ai13;Ifa4;IFN-alpha-4;interferon 1ai13;interferon alpha family, gene 4;interferon alpha-4;MuIFN-alpha 4
Extra Details:: The interferons (IFN) are a family of cytokines with potent antiviral, antiproliferative and immunomodulatory properties, and are classified based on their binding specificity to cell surface receptors . The type I IFNs bind to the interferon alpha receptor (IFNAR), which consists of two subunits: IFNAR1 ( alpha -subunit) and IFNAR2 ( beta -subunit). This binding contributes to TNF-alpha induced signaling .