Recombinant Human Alkaline phosphatase (Intestinal type)/ALPI Protein

Size

£193.00

SKU:: RP00679
Additional Names:: ALPI, Intestinal-type alkaline phosphatase, IAP, Intestinal alkaline phosphatase, EC:3.1.3.1
Molecular Weight:: 60-75 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Val20-Thr502
Formulation:: Recombinant Human Alkaline phosphatase (Intestinal type)/ALPI Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val20-Thr502) of Human Alkaline phosphatase (Intestinal type)/ALPI (Accession #NP_001622.2) fused with His tag at the C-terminus.
Species:: Human
Sequence:: VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTT
Uniprot:: P09923
Synonyms:: alkaline phosphomonoesterase;glycerophosphatase;IAP;intestinal alkaline phosphatase;intestinal-type alkaline phosphatase;Kasahara isozyme
Extra Details:: Recombinant Human Alkaline phosphatase (Intestinal type)/ALPI Protein encodes for intestinal phosphatase alkaline, a brush border metalloenzyme that hydrolyses phosphate from the lipid A moiety of lipopolysaccharides and thereby drastically reduces Toll-like receptor 4 agonist activity. ALPI mutations impaired either stability or catalytic activity of ALPI and rendered it unable to detoxify lipopolysaccharide-dependent signalling. ALPI mutations should be included in screening for monogenic causes of inflammatory bowel diseases and lay the groundwork for ALPI-based treatments in intestinal inflammatory disorders.

Shipping Conditions:: Blue Ice