Recombinant Mouse/Rat Mature TGF-beta 1 Protein

Size

£193.00

SKU:: RP00671
Additional Names:: TGF-beta1,Tgfb,Tgfb-1,TGFbeta1,CED,DPD1,LAP,TGFB,TGFbeta,TGFB1
Molecular Weight:: 15 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ala279-Ser390
Formulation:: Recombinant Mouse TGF-beta 1/TGFB1 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala279-Ser390) of mouse TGF-beta 1/TGFB1 (Accession #P04202).
Species:: Mouse
Sequence:: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Uniprot:: P04202
Synonyms:: TGF-beta;TGF-beta1;Tgfb;Tgfb-1;TGFbeta;TGFbeta1;transforming growth factor beta-1 proprotein
Extra Details:: Transforming growth factor beta 1 (TGFB Beta1) is the prototype of a growing superfamily of peptide growth factorsand plays a prominent role in a variety of cellular processes, including cell-cycle progression, celldifferentiation,reproductivefunction,development,motility,adhesion,neuronalgrowth,bonemorphogenesis, wound healing, and immune surveillance. TGF- B Beta 1, TGF- B Beta 2 and TGF- B Beta 3 signal via the sameheteromeric receptor complex, consisting of a ligand binding TGF- B Beta receptor type II (T B Beta R-II), and a TGF- B Betareceptor type I (T B Beta R-I). Signal transduction from the receptor to the nucleus is mediated via SMADs. TGF- B Betaexpression is found in cartilage, bone, teeth, muscle, heart, blood vessels, haematopoitic cells, lung, kidney,gut, liver, eye, ear, skin, and the nervous system.

Shipping Conditions:: Blue Ice