Recombinant Human/Mouse/Rat mature TGF-beta 3 Protein

Size

£193.00

SKU:: RP00645
Additional Names:: TGFB3,ARVD,ARVD1,LDS5,RNHF,TGF-beta3
Molecular Weight:: 13-16 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ala301-Ser412(Y340F)
Formulation:: Recombinant Human/Mouse/Rat TGF-beta 3 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala301-Ser412(Tyr340Phe)) of human TGF-beta 3/TGFB3 (Accession #P10600).
Species:: Human
Sequence:: ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
Uniprot:: P10600
Synonyms:: ARVD;ARVD1;LDS5;prepro-transforming growth factor beta-3;RNHF;TGF-beta3;transforming growth factor beta-3 proprotein
Extra Details:: Transforming growth factor beta 3(TGFB3) is a member of a TGF - B Beta superfamily which is defined bytheirstructural and functional similarities. TGFB3 is secreted as a complex with LAP. This latent form ofTGFB3becomes active upon cleavage by plasmin, matrix metalloproteases, thrombospondin -1, and a subsetofintegrins. It binds with high affinity to TGF- B Beta RII, a type II serine/threonine kinase receptor. TGFB3 is involvedincell differentiation, embryogenesis and development.It is believed to regulate molecules involved incellularadhesion and extracellular matrix (ECM) formation during the process of palate development. WithoutTGF-B Beta3,mammals develop a deformity known as a cleft palate.

Shipping Conditions:: Blue Ice