Recombinant Human IL-23A&Mouse IL-12B Protein

Size

£586.00

SKU:: RP00632
Additional Names:: IL12 beta|IL12 B Beta|IL23 alpha|IL23 alpha&IL12 beta|IL23 alpha&IL12 B Beta
Molecular Weight:: 22 kDa (Human IL-23 alpha), 45-60 kDa (Mouse IL-12 beta)
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Arg20-Pro189(Human IL-23 alpha) & Met23-Ser335(Mouse IL-12 beta)
Formulation:: Recombinant Human IL-23A&Mouse IL-12B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg20-Pro189(Human IL-23 alpha) & Met23-Ser335(Mouse IL-12 beta)) of Human IL-23 alpha&Mouse IL-12 beta (Accession #Q9NPF7(Human IL-23 alpha)&P43432-1(Mouse IL-12 beta)) fused with a C-His&Avi tag at the C-terminus.
Species:: Human, Mouse
Sequence:: RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSPMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
Uniprot:: P43432-1, Q9NPF7
Synonyms:: CLMF p40;cytotoxic lymphocyte maturation factor 40 kDa subunit;Il-1;Il-12;IL-12 p40 subunit;IL-12 subunit p40;Il-12b;Il-12p40;IL-23;IL-23 subunit alpha;IL-23 subunit p40;IL-23-A;IL-23A;IL-23p19;Il12p40;IL23P19;interleukin 23 p19 subunit;interleukin 23, alpha subunit p19;interleukin-12 p40 subunit;interleukin-12 subunit beta;interleukin-23 subunit alpha;interleukin-23 subunit p19;interleukin-six, G-CSF related factor;JKA3 induced upon T-cell activation;P19;p40;SGRF
Extra Details:: Interleukin (IL)-12 and IL-23 belong to the IL-12 type family and are composite cytokines, consisting of the common B Beta subunit p40 and the specific cytokine A Alpha subunit p35 and p19, respectively. IL-12 signals via the IL-12RB Beta1 IL-12RB Beta2 receptor complex, and IL-23 uses also IL-12RB Beta1 but engages IL-23R as second receptor.

Shipping Conditions:: Blue Ice