RP00623
Recombinant Human CD3E&CD3D Protein

Size
£508.00
- SKU:
- RP00623
- Additional Names:
- CD3|CD3 delta&CD3 epsilon|CD3d|CD3e|CD3E&CD3D|T3D
- Molecular Weight:
- 28-38 kDa (CD3E), 25 kDa(CD3D)
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Asp23-Glu120(CD3E) & Phe22-Ala105(CD3D)
- Formulation:
- Recombinant Human CD3E&CD3D/CD3 epsilon&CD3 delta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp23-Glu120(CD3E) & Phe22-Ala105(CD3D)) of Human CD3E&CD3D/CD3 epsilon&CD3 delta (Accession #P07766(CD3E)&P04234(CD3D)) fused with a C-His tag at the C-terminus.
- Species:
- Human
- Sequence:
- DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCEFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
- Uniprot:
- P04234, P07766
- Synonyms:
- CD3 antigen, delta subunit;CD3 delta;CD3-DELTA;CD3-epsilon;CD3d antigen, delta polypeptide (TiT3 complex);CD3d molecule, delta (CD3-TCR complex);CD3e antigen, epsilon polypeptide (TiT3 complex);CD3e molecule, epsilon (CD3-TCR complex);IMD18;IMD19;OKT3, delta chain;T-cell antigen receptor complex, epsilon subunit of T3;T-cell receptor T3 delta chain;T-cell surface antigen T3/Leu-4 epsilon chain;T-cell surface glycoprotein CD3 delta chain;T-cell surface glycoprotein CD3 epsilon chain;T3D;T3E;TCRE
- Extra Details:
- T-cell surface glycoprotein CD3 epsilon & CD3 delta chain, also known as CD3E & CD3D , are single-pass type I membrane proteins.When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain.
- Shipping Conditions:
- Blue Ice







