Recombinant Mouse IL-33 Protein

Size

£145.00

SKU:: RP00618
Additional Names:: Il33, Il1f11, NF-HEV, 9230117N10Rik,IL-33
Molecular Weight:: 18 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ser109-Ile266
Formulation:: Recombinant Mouse IL-33 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser109-Ile266) of mouse IL-33 (Accession #Q8BVZ5) fused with an initial Met at the N-terminus.
Species:: Mouse
Sequence:: SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Uniprot:: Q8BVZ5
Synonyms:: 9230117N10Rik;Il-;Il-33;Il1f;Il1f11;interleukin-33;NF-H;NF-HEV;nuclear factor from high endothelial venules
Extra Details:: Mouse Interleukin 33 (IL-33) is a proinflammatory cytokine which may also regulates gene transcription inproducer cells. IL-33 is structurally related to IL-1, which induces helper T cells to produce type 2 cytokines andacts through the receptor IL1RL-1. BindingIL-33 to this receptor activates NF-kappa-B and MAP kinases andinduces in vitro Th2 cells to produce cytokines. In vivo, IL-33 induces the expression of IL-4, IL-5, IL-13 and alsoleads to severe pathological changes in mucosal organs.