RP00612B
Biotinylated Recombinant Human TNFRSF17/BCMA/CD269 Protein
Size
£657.00
- SKU:
- RP00612B
- Additional Names:
- BCM|BCMA|CD269|TNFRSF13A|TNFRSF17
- Molecular Weight:
- 12, 15-17 kDa
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Met1-Ala54
- Formulation:
- Biotinylated Recombinant Human TNFRSF17/BCMA/CD269 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Ala54) of Human TNFRSF17/BCMA/CD269 (Accession #Q02223-1) fused with a C-His&Avi tag at the C-terminus.
- Species:
- Human
- Sequence:
- MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
- Uniprot:
- Q02223-1
- Synonyms:
- B cell maturation antigen;B-cell maturation factor;B-cell maturation protein;BCM;BCMA;CD269;TNFRSF13A;tumor necrosis factor receptor superfamily member 17
- Extra Details:
- B-cell maturation antigen (BCMA or BCM), also known as tumor necrosis factor receptor superfamily member 17 (TNFRSF17), is a protein that in humans is encoded by the TNFRSF17 gene.TNFRSF17 is a cell surface receptor of the TNF receptor superfamily which recognizes B-cell activating factor (BAFF).
- Shipping Conditions:
- Blue Ice