RP00601
Recombinant Human CD3 epsilon Protein
Size
£395.00
- SKU:
- RP00601
- Additional Names:
- CD3-epsilon|CD3e|FLJ18683|IMD18|T3E|TCRE
- Molecular Weight:
- 35-55 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Asp23-Asp126(C119S, C122S)
- Formulation:
- Recombinant Human CD3 epsilon Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp23-Asp126) of Human CD3 epsilon (Accession #P07766) fused with a C-hFc tag at the C-terminus.
- Species:
- Human
- Sequence:
- DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVSENSMEMD
- Uniprot:
- P07766
- Synonyms:
- CD3-epsilon;CD3e antigen, epsilon polypeptide (TiT3 complex);CD3e molecule, epsilon (CD3-TCR complex);IMD18;T-cell antigen receptor complex, epsilon subunit of T3;T-cell surface antigen T3/Leu-4 epsilon chain;T-cell surface glycoprotein CD3 epsilon chain;T3E;TCRE
- Extra Details:
- T-cell surface glycoprotein CD3 epsilon & CD3 gamma chain, also known as CD3E & CD3G , are single-pass type I membrane proteins.When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain.
- Shipping Conditions:
- Blue Ice