Biotinylated Recombinant Human CD7 Protein

Size

£657.00

SKU:: RP00588B
Additional Names:: CD7|CD7 molecule|GP40|LEU-9|Tp40|TP41
Molecular Weight:: 34-48 kDa
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ala26-Pro180
Formulation:: Biotinylated Recombinant Human CD7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala26-Pro180) of Human CD7 (Accession #P09564) fused with a C-His&Avi tag at the C-terminus.
Species:: Human
Sequence:: AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
Uniprot:: P09564
Synonyms:: CD7 antigen (p41);GP40;LEU-9;p41 protein;T-cell antigen CD7;T-cell leukemia antigen;T-cell surface antigen Leu-9;Tp40;TP41
Extra Details:: CD7, also known as Leu-9, is an approximately 40 kDa glycosylated and palmitoylated transmembrane protein in the immunoglobulin superfamily.CD7 is expressed on T cells, NK cells , myeloid progenitor cells, and CD19 B progenitor cells. Among CD8 T cells, the CD7-bright population preferentially contains na?ve and memory cells, while more weak expressors are primarily effector cells.