Biotinylated Recombinant Human CD8 alpha Protein

Size

£657.00

SKU:: RP00587B
Additional Names:: CD8|CD8a|CD8a molecule|Leu2|Lyt-2|MAL|OKT8 T-cell antigen|p32
Molecular Weight:: 30-38 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ser22-Asp182
Formulation:: Biotinylated Recombinant Human CD8 alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser22-Asp182) of Human CD8 alpha (Accession #P01732-1) fused with a C-His&Avi tag at the C-terminus.
Species:: Human
Sequence:: SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
Uniprot:: P01732-1
Synonyms:: CD8;CD8 antigen, alpha polypeptide (p32);Leu2;Leu2 T-lymphocyte antigen;OKT8 T-cell antigen;p32;T cell co-receptor;T-cell antigen Leu2;T-cell surface glycoprotein CD8 alpha chain;T-lymphocyte differentiation antigen T8/Leu-2;T8 T-cell antigen
Extra Details:: CD8 alpha enhances the responses of antigen-specific CTL activated through TCR through binding MHC class I, favoring lipid raft partitioning of TCR, and inducing intracellular signaling. CD8 alpha is also found on dendritic cells and rat macrophages, but whether CD8 alpha enhances responses of a partner receptor, like TCR, to activate these cells is not known.