Biotinylated Recombinant Human Siglec-2/CD22 Protein

Size

£657.00

SKU:: RP00578B
Additional Names:: B-cell receptor CD22|BL-CAM|CD22|CD22 molecule|Siglec-2|SIGLEC2|SIGLEC2FLJ22814
Molecular Weight:: 110-120 kDa
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Asp20-Arg687
Formulation:: Biotinylated Recombinant Human Siglec-2/CD22 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp20-Arg687) of Human Siglec-2/CD22 (Accession #P20273-1) fused with a C-His&Avi tag at the C-terminus.
Species:: Human
Sequence:: DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR
Uniprot:: P20273-1
Synonyms:: B-cell receptor CD22;B-lymphocyte cell adhesion molecule;BL-CAM;CD22 antigen;sialic acid-binding Ig-like lectin 2;SIGLEC-2;SIGLEC2;T-cell surface antigen Leu-14
Extra Details:: CD22, or cluster of differentiation-22, is a molecule belonging to the SIGLEC family of lectins. It is found on the surface of mature B cells and to a lesser extent on some immature B cells. CD22 a member of the immunoglobulin superfamily. CD22 functions as an inhibitory receptor for B cell receptor (BCR) signaling. It is also involved in the B cell trafficking to Peyer's patches in mice.

Shipping Conditions:: Blue Ice