Recombinant Human IFN-alpha 6 Protein

Size

POA

SKU:: RP00540
Additional Names:: IFNA6,IFN-alphaK
Molecular Weight:: 15-20 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ser21-Glu189
Formulation:: Recombinant Human IFN-alpha 6 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ser21-Glu189) of human IFNA6/IFN-alpha 6/LeIF K (Accession #P05013) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE
Uniprot:: P05013
Synonyms:: IFN-alpha-6;IFN-alphaK;interferon alpha-54;interferon alpha-6;interferon alpha-K;leIF K
Extra Details:: Interferon A Alpha-6 (IFN-A Alpha6) is a secreted protein which belongs to the A Alpha/B Beta interferon family. IFN-A Alpha6 is produced bymacrophages, expressed at low level, only 1.0% of the average gene in this release. IFN-A Alpha6 contains interferonalpha, beta and delta domain. IFN- A Alpha has antiviral activities. Interferon stimulates the production of twoenzymes: a protein kinase and an oligoadenylate synthetase.