Recombinant Human IL-20RA Protein

Size

£145.00

SKU:: RP00537
Additional Names:: IL20RA,CRF2-8,IL-20R-alpha,IL-20R1,IL-20RA
Molecular Weight:: 60 kda
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Val30-Lys250
Formulation:: Recombinant Human IL-20RA/IL-20 R alpha Protein is produced by Human cells expression system. The target protein is expressed with sequence (Val30-Lys250) of human IL-20RA/IL-20 R alpha (Accession #Q9UHF4) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK
Uniprot:: Q9UHF4
Synonyms:: class II cytokine receptor ZCYTOR7;CRF2-8;Cytokine receptor class-II member 8;cytokine receptor family 2 member 8;IL-20R-alpha;IL-20R1;IL-20RA;interleukin 20 receptor alpha subunit;interleukin 20 receptor, alpha;interleukin-20 receptor I;interleukin-20 receptor subunit alpha;ZcytoR7
Extra Details:: Interleukin-20 Receptor Subunit A Alpha (IL20RA) is a single-pass type I membrane protein that is a member of thetype II cytokine receptor family. IL20RA is synthetized a 553 amino acid glycoprotein precursor containing a 29amino acid signal peptide, a 221 amino acid extracellular domain with two fibronectin type-III domains, a 24amino acid transmembrane region, and a 279 amino acid intracellular domain. IL20RA is widely expressed withhighest levels found in skin and testis and high levels in brain. IL20RA forms a heterodimer with IL20RB, andthe complex serves as a receptor for IL19, IL20 and IL24. IL20RA also forms a heterodimer with the unique andspecific receptor IL10RB and functions as the receptor for IL26.

Shipping Conditions:: Blue Ice