Biotinylated Recombinant Human TNFSF7/CD27 Ligand/CD70 Trimer Protein (Primary Amine Labeling)

Size

£657.00

SKU:: RP00526B
Additional Names:: ?Ki-24 antigen|CD27 Ligand|CD27-L|CD27LG|CD70|CD70 molecule|TNFSF7|TNFSF7G
Molecular Weight:: 55-70 kDa
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Leu50-Pro193
Formulation:: Biotinylated Recombinant Human TNFSF7/CD27 Ligand/CD70 Trimer Protein (Primary Amine Labeling) is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu50-Pro193) of Human TNFSF7/CD27 Ligand/CD70 Trimer (Primary Amine Labeling) (Accession #P32970-1) fused with a N-His tag at the N-terminus.
Species:: Human
Sequence:: LESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Uniprot:: P32970-1
Synonyms:: CD27 ligand;CD27-L;CD27L;CD27LG;CD70 antigen;Ki-24 antigen;LPFS3;surface antigen CD70;TNFSF7;TNLG8A;tumor necrosis factor ligand 8A;tumor necrosis factor ligand superfamily member 7
Extra Details:: CD70, also named CD27 ligand (CD27L), is a type II transmembrane glycoprotein belonging to the TNF superfamily (TNFSF) and has been designated TNFSF7.? CD70 is a cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.