Recombinant Human FAM3C Protein

Size

£145.00

SKU:: RP00514
Additional Names:: FAM3C,GS3786,ILEI
Molecular Weight:: 20-25 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gln25-Asp227
Formulation:: Recombinant Human FAM3C Protein is produced by Human cells expression system. The target protein is expressed with sequence (Gln25-Asp227) of human FAM3C (Accession #Q92520) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: QVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD
Uniprot:: Q92520
Synonyms:: family with sequence similarity 3 member C;GS3786;ILEI;interleukin-like EMT inducer;interleukin-like epithelial-mesenchymal transition inducer;predicted osteoblast protein;protein FAM3C
Extra Details:: FAM3C, also called interleukin-like EMT inducer, usually exist in most secretory epithelia. It belongs to theFAM3 family according to their sequence similarities. The up-regulation and/or mislocalization in breast cancerand liver carcinoma cells of FAM3C is strongly correlated with metastasis formation and survival. FAM3C can beinvolved in retinal laminar formation and promote epithelial to mesenchymal transition.