RP00489
Recombinant Human Fc-epsilon RI-alpha/FCER1A Protein
Size
£336.00
- SKU:
- RP00489
- Additional Names:
- Fc-epsilon RI-alpha|FCE1A|FCER1A|FcERI
- Molecular Weight:
- 70-78 kDa
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Val26-Gln205
- Formulation:
- Recombinant Human Fc-epsilon RI-alpha/FCER1A Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val26-Gln205) of Human Fc-epsilon RI-alpha/FCER1A (Accession #P12319-1) fused with a C-hFc tag at the C-terminus.
- Species:
- Human
- Sequence:
- VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ
- Uniprot:
- P12319-1
- Synonyms:
- Fc epsilon receptor Ia;Fc epsilon RI alpha-chain;Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide;Fc IgE receptor, alpha polypeptide;Fc-epsilon RI-alpha;FCE1A;FcERI;high affinity immunoglobulin epsilon receptor alpha-subunit;high affinity immunoglobulin epsilon receptor subunit alpha;igE Fc receptor subunit alpha;immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide
- Extra Details:
- Known susceptibility genes to atopy and asthma have been identified by linkage or associations with clinical phenotypes, including total serum IgE levels. IgE-mediated sensitivity reactions require a high-affinity IgE receptor (FcepsilonRI), which immobilizes the immunoglobulin on the surface of the effector cells, mostly mast cells and basophils. Similarly to the previously investigated beta subunit of the receptor, FCER1A is a good candidate for a quantitative trait locus (QTL) in allergic diseases, and appears to participate in the systemic regulation of IgE levels.
- Shipping Conditions:
- Blue Ice