Recombinant Human Fc gamma RIIA/FCGR2A/CD32a Protein

Size

£336.00

SKU:: RP00481
Additional Names:: CD32A|Fc gamma RIIA|FCG2|FCGR2|FCGR2A|FCGR2A1|FcgRIIA|fcRII-a|FCRIIA
Molecular Weight:: 30-40 kDa
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ala36-Ile218
Formulation:: Recombinant Human Fc gamma RIIA/FCGR2A/CD32a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala36-Ile218) of Human Fc gamma RIIA/CD32a (Accession #P12318-1) fused with a C-His&Avi tag at the C-terminus.
Species:: Human
Sequence:: AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI
Uniprot:: P12318-1
Synonyms:: CD32;CD32A;CDw32;Fc fragment of IgG, low affinity IIa, receptor (CD32);Fc gamma receptor RIIa3;Fc-gamma RII-a;fc-gamma-RIIa;FCG2;FcGR;FCGR2;FCGR2A1;fcRII-a;IGFR2;igG Fc receptor II-a;Immunoglobulin G Fc receptor II;low affinity immunoglobulin gamma Fc region receptor II-a
Extra Details:: The Fc gamma Rs have been divided into three classes based on close relationships in their extracellular domains; these groups are designated Fc gamma RI (also known as CD64), Fc gamma RII (CD32), and Fc gamma RIII (CD16). Each group may be encoded by multiple genes and exist in different isoforms depending on species and cell type.

Shipping Conditions:: Blue Ice